top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|80837855|80838053|1|198|0

ENST00000385268

Open Reading Frame (ORF)

LGGLLHTAHLGQPEGQSGKCIGRSPWEKGCSHLRWVNKEVGVASGGHRGKQ

Peptide

WVNKEVGVASGGHR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

14

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

43 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page