top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|80120327|80122800|3|130,93,101|0,1400,2372

ZFAND6

Open Reading Frame (ORF)

MHRWQCARSPVSIRLYIFIYAAQPCIKSVTFIRICSIFSIGQYICGQSST

Peptide

WQCARSPVSIR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

11

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 34 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

TRUE

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

true

false

bottom of page