top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|77180122|77180241|1|119|0

PEAK1

Open Reading Frame (ORF)

LLSHLICLKLNLIVITMLEKLSQISTYITHSYKHFLQNHPC

Peptide

LNLIVITMLEK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

11

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

27 7 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page