top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|76287845|76292700|3|100,83,82|0,4585,4773

ETFA

Open Reading Frame (ORF)

LVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKLEVAPISDIIAIKSPDTFVRTIYAGGTRSL

Peptide

SPDTFVRTIYAGGTR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Junction

Junction

Peptide Length

Frame

Start Codon

15

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 34 12 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page