top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|74890552|74891489|2|102,111|0,826

MPI

Open Reading Frame (ORF)

MPGGRWVPTAKWRGCWPAVIHWPRSQRTSLMQSCGWGLTPEGMPRSLTTASHRRP

Peptide

SQRTSLMQSCGWGLTPEGMPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

21

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

26 38 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page