top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|66702891|66703061|1|170|0

SMAD6

Open Reading Frame (ORF)

LELLSSPAAVVHVAAGRARTAARRARVPGPAQLLKARRPMWGLSGGAPPAAPLKRGGWSC

Peptide

LELLSSPAAVVHVAAGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

17

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

52 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page