top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|65581953|65595825|3|66,87,93|0,11532,13779

INTS14

Open Reading Frame (ORF)

MRWVLASLMTMKMKIQPIRLQAKYPTFTDVQKILRNARKLPEKTQTFYKIWK

Peptide

WVLASLMTMKMK

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

12

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 37 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page