top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|52292760|52293024|1|264|0

XR_932250.2

Open Reading Frame (ORF)

LLKLKVEGAGAMSKGDRQRLRQVEFVCQGTQWQRASKALREWQGVWQSMSQVRAGRQGERQDLVAGQ

Peptide

EWQGVWQSMSQVRAGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

16

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

49 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page