top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|44497026|44503850|2|43,297|0,6527

CTDSPL2

Open Reading Frame (ORF)

LKISKINKLWVSCPEIRLCYYFIKHVPPLTEEQHLLNDLPLSPSRTGAQFFEDVIELLSPNVAD

Peptide

LWVSCPEIR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 28 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page