top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|43021274|43025429|3|101,235,56|0,3474,4099

UBR1

Open Reading Frame (ORF)

LGSSAMNIQMLLEKLKGIPQLEGQKDMITWILQAEHMQKKRRKQENKDEGKNIAATTTS

Peptide

MITWILQAEHMQK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

13

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 21 19 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page