top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|40853710|40853881|1|171|0

SPINT1

Open Reading Frame (ORF)

LQEFRLWRLLGQQEQLPSGRRVHSSLSGCARLLPRIQQGGSLPGLFPTLVL

Peptide

IQQGGSLPGLFPTLVL

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

16

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA,PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 48 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page