top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|96565812|96565972|1|160|0

PAPOLA

Open Reading Frame (ORF)

LFVCFEDNRGSLVSHHGLRKYWHFVSYEVSPTLCIQAKRKRKKTGEGKAQEAFFVCLF

Peptide

GSLVSHHGLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

31 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page