top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|94378511|94380969|3|129,148,99|0,952,2359

SERPINA1

Open Reading Frame (ORF)

LMRGNYSTWKMNSPTISSPSSWKMKTEGLPAYIYPNCPLLEPMI

Peptide

TEGLPAYIYPNCPLLEPMI

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

19

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

7 50 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page