top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|92706600|92709710|2|53,39|0,3071

LGMN

Open Reading Frame (ORF)

MPGTSLRSQCVRSSPCWQLQAAHGGDPAASGCQAPH

Peptide

MPGTSLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

4

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

2 12 2 4 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page