top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|70988566|71009724|2|46,86|0,21072

PCNX1

Open Reading Frame (ORF)

LYETGGCDMSLVNFEPAARRASNICSTSQRGGSVISP

Peptide

ASNICSTSQRGGSVISP

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

17

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 14 37 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page