top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|50443734|50445145|3|36,98,105|0,204,1306

MAP4K5

Open Reading Frame (ORF)

LIQKAELPKFSEDRVAQVVGLWQRLLLLEMVMVFQN

Peptide

LLLLEMVMVFQN

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

12

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

12 24 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page