top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|35403293|35404515|3|67,109,98|0,396,1124

NFKBIA

Open Reading Frame (ORF)

MVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGSDGQGAAGDPPRAAGGAARLGALEAAAHRGRGLVPALGHHP

Peptide

AAGGAARLGALEAAAHR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

17

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

52 0 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page