top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|22923135|22924077|2|25,70|0,872

PRMT5

Open Reading Frame (ORF)

LGSFADNELSPECLDGAQHFLKDDGVSIPGDFWAHLLTMNCRLSAWMEPSTS

Peptide

DDGVSIPGDFWAHLLTMNCRLSAWMEPSTS

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

30

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

5

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

4 22 47 2 9

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page