top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|21102721|21103213|2|58,75|0,417

TMEM253

Open Reading Frame (ORF)

LHYQELQEGFSELEEVPGLENGPTVASTGANERPEETRMLQEPESALSRAAGGLL

Peptide

MLQEPESALSR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

11

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page