top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|20343146|20343407|1|261|0

RPPH1

Open Reading Frame (ORF)

LGRSETRARGGPNRALPELRGGEFPENGAPREVRLGRRCRGPRPSGRGPADASFAGAWNRLTASEGGGKLISGATS

Peptide

GPADASFAGAWNRLTASEGGGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

22

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

54 13 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page