top of page

CircRNA

Gene

chr14|20343123|20343407|1|284|0

RPPH1

Open Reading Frame (ORF)

LGRSETRARGGPNRALPELRGGEFPENGAPREVRLGRRCRGPRPSGRGPADASFAGAWNRLTASEVSSMAEVRAEGSSSVGPRAECVLSLHSHVPWEGLRLGPEAALTGLSLSFGEVSSQRTGLRARSDWAGDAVDPALRGGARRMPPLPELGTDSRPAK

Peptide

AEGSSSVGPR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

31 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page