top of page

CircRNA

Gene

chr14|20343070|20343263|1|193|0

ENSG00000259001

Open Reading Frame (ORF)

LGRRCRGPRPSGRGPADASFAGAWNRLTASEVSSMAEVRYPAGDLITQFRLLSSAH

Peptide

GPADASFAGAWNRLTASEVSSMAEVR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Alternative

Peptide Length

Frame

Start Codon

26

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

79 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page