top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|100856639|100856818|1|179|0

MEG3

Open Reading Frame (ORF)

LGRNFHARGLGDSLDNAPGPPGGTRSRSPLRGWKRLAVLSECCVLPASVPGGVYGGTGGIWAGTFMLGVWGTRWTMPLDPPGVRVHAHL

Peptide

NFHARGLGDSLDNAPGPPGGTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

22

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

67 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page