top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|29511516|29511679|1|163|0

SLC7A1

Open Reading Frame (ORF)

LPSCKPAPEPAANKAPTASLETHFIPLFSRGPEAGGGGCVEAWSPPDGAPPNCRAALL

Peptide

APTASLETHFIPLFSRGPEAGGGGCVEAWSPPDGAPPNCR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

40

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

65 56 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page