top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|21375139|21375362|1|223|0

ZDHHC20

Open Reading Frame (ORF)

LIASSEWVEMNLSSICEYYRLELPVCKMGLQGRGCCE

Peptide

LELPVCKMGLQGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

13

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

40 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page