top of page

CircRNA

Gene

chr12|6599825|6600315|2|187,99|0,391

CHD4

Open Reading Frame (ORF)

LSFFLPHPLPESSCVIPVPVLTTWSAWIPTWRRLPRASGAAHTARRKASSGKLKRTIRRVRRSWKRLGETSKRRMTTIWNSVGSARMVGNCSAVIPVLLPTTSTA

Peptide

ASGAAHTAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

23 5 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page