top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|64080295|64091372|3|75,28,97|0,6703,10980

SRGAP1

Open Reading Frame (ORF)

MFPLSPRNTGSPGPAHSIILSCLMGIWKHSIFGRQ

Peptide

MFPLSPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 22 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page