top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|57254474|57255046|1|572|0

R3HDM2

Open Reading Frame (ORF)

LAIRSLKRLTELLRRREAFWAARGLGNTATMVYKAARSEWRPFSAVPLLSPPPPPGSP

Peptide

REAFWAAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

8

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page