top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|55831349|55831574|1|225|0

TMEM198B

Open Reading Frame (ORF)

LSLLNSSSQTLGRKSPTNILRGGASGYQDVRCLWAKSLLIP

Peptide

LSLLNSSSQTLGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

13

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 6 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page