top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|49792173|49792521|1|348|0

NCKAP5L

Open Reading Frame (ORF)

LYLQPVSSEVYPTRAAGSSSDPLMCPPRQLEGLPRTPMVRIAAEERERTREQEGVMWGDQFLQ

Peptide

LYLQPVSSEVYPTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

14

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

38 5 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page