top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|48938882|48939712|2|226,58|0,772

ENSG00000272822

Open Reading Frame (ORF)

LLRSQTSWACIPFVTVTGTFRPPVPPAGTGCTKAWTGWPISSKTRSESQTALTKHPTHP

Peptide

SQTSWACIPFVTVTGTFRPPVPPAGTGCTK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

30

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 91 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page