top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|3615185|3615415|1|230|0

CRACR2A

Open Reading Frame (ORF)

LHRCHPPGPAQSFSLSVTHLPQKEGKHIPSGELSERGHHSGRPPC

Peptide

HIPSGELSER

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

10

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

21 10 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page