top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|119686684|119686903|1|219|0

CIT

Open Reading Frame (ORF)

LPLISHKASVALGSLRKQPQLNSSSSARVGKSLGAVRLPLGLRTLLLEYEIPGNWYRTNLEALQLAS

Peptide

ASVALGSLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

9

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

16 12 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page