top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|112236944|112239196|2|154,145|0,2107

HECTD4

Open Reading Frame (ORF)

LPSRCLPTAVLSGKKRKVAPQRLCTQVWPGRCPAFSLTILPEPQSAVATRLLGMTRSRMSLVFSMISQAHGSTV

Peptide

CLPTAVLSGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

31 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page