top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|70354300|70362488|2|61,28|0,8160

PPFIA1

Open Reading Frame (ORF)

LPPSREEVRDDKTTIKCETSPRLPRPHLERCHLPEKRYEMTRQP

Peptide

TTIKCETSPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 6 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page