top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|46719752|46723263|4|110,25,51,84|0,770,1037,3427

F2

Open Reading Frame (ORF)

MEDQHLLGGGAQGQPGARVRGGDVQLRGGLRGSGVLHGYGCVLGQVHSL

Peptide

MEDQHLLGGGAQGQPGAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

18

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116,PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 0 8 47 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page