top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|4092415|4092558|1|143|0

STIM1

Open Reading Frame (ORF)

LASTHAPMNRCLSQPIPKPGLSLKVSGGLEAGVGGSREKK

Peptide

VSGGLEAGVGGSR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

13

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

14 26 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page