top of page

CircRNA

Gene

chr11|4092316|4092582|1|266|0

STIM1

Open Reading Frame (ORF)

LVLMWVRRSLILISLRPPGIHGGVKPILREQPTRDF

Peptide

LVLMWVR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

7

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page