top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|36393845|36419303|4|112,271,81,49|0,7169,9452,25409

PRR5L

Open Reading Frame (ORF)

LEQRSDCCDQRFQRGWLAKQRALCPERKHQAAVEE

Peptide

HQAAVEE

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 6 15 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

TRUE

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page