top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|120485518|120485786|1|268|0

ARHGEF12

Open Reading Frame (ORF)

MPCGSYVPRWCGQRVDGLPPALRQAPLLPKDQLLLKQRGQDGVCRSWVERLRRGGSETGKGGAPCFTIQYSKLSAVQ

Peptide

MPCGSYVPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

28 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page