top of page

CircRNA

Gene

chr11|119094888|119095185|1|297|0

H2AX

Open Reading Frame (ORF)

LPPEGAFGPTVALVFLGSSTAWMLGRTPPWAIVTPPSSLLSSSSLRMASCRWRGMIRVFLLSRAGGGGP

Peptide

VFLLSRAGGGGP

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

12

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

21 15 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page