top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|119048023|119048772|4|57,123,88,59|0,224,452,690

HYOU1

Open Reading Frame (ORF)

LPTAWKHSYLRPRTSCTSPSTRKCPQRSSVRRSLGSSAPHPPGWRMRVLEPPQ

Peptide

SLGSSAPHPPGWRMR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

15

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

6

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 2 8 3 3 3 21 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page