top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|99403554|99403811|2|80,88|0,169

GOT1

Open Reading Frame (ORF)

MPGPFAILCLKASSSSVPSPSPRTSGSTMRESGI

Peptide

MPGPFAILCLKASSSSVPSPSPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

23

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

70 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page