top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|93593883|93594035|1|152|0

RBP4

Open Reading Frame (ORF)

LNLDGTCADSYSFVFSRDPNGLPPEAQKIMMTTGSSTQTTTRMPCSTPAAS

Peptide

IMMTTGSSTQTTTRMPCSTPAAS

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

23

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

3 66 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page