top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|86968492|86970228|2|113,29|0,1707

ADIRF

Open Reading Frame (ORF)

LLLTTPQIPRSHGKQGLAGPEATGGGDRPGSRVSGRSGSSARSNVAPAALDDSTDTPKPWQARACRT

Peptide

QGLAGPEATGGGDRPGSRVSGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

22

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA,PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

53 14 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page