top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|86962606|86963072|2|69,108|0,358

SNCG

Open Reading Frame (ORF)

LPPNRRVRHPKRKRKWQRRPRVGETRGLQASVDDLKSAPLPWTPSPPSTRSARLET

Peptide

SAPLPWTPSPPSTRSAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

17

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 52 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page