top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|7797046|7802854|2|105,57|0,5751

ATP5F1C

Open Reading Frame (ORF)

LKLSLVLQLFTRRLKSIKNIQKITKSMKMVAAAKYARAERELKPAAKLSSQKS

Peptide

LSLVLQLFTRR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

11

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 22 12 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page