top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|71817308|71818636|2|168,20|0,1308

PSAP

Open Reading Frame (ORF)

LAETTALVFFYLCVWGNERTDLFDFVIKIGLPHLPHFCRQQPSAMLSSIANAMCGTRRRNIPSWQKPQHWFFSTCVSGGMNAQICLTLL

Peptide

IGLPHLPHFCRQQPSAMLSSIANAMCGTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

29

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 30 20 38 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page