top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|68786641|68787957|2|51,31|0,1285

CCAR1

Open Reading Frame (ORF)

LEEILYTLGLHLSRAQVKKLLNKVVLRFGRNTLYSWTTSFSGSGKEAS

Peptide

NTLYSWTTSFSGSGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

15

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

40 6 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page