top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|122426949|122429636|2|82,13|0,2674

PLEKHA1

Open Reading Frame (ORF)

MHSWIKAVSGAIVAQRGPGRSASSEHPPALKRCTVGLKQSLAPL

Peptide

GPGRSASSEHPPALK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

15

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

3

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

24 13 9 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page